hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-09180644/chunk_1/iprscan-20080502-09180644.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0656 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00273 174.0 1.4e-47 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00273 1/1 25 150 .. 1 137 [] 174.0 1.4e-47 Alignments of top-scoring domains: SM00273: domain 1 of 1, from 25 to 150: score 174.0, E = 1.4e-47 *->sdlevkVrkATnndewgpkgkhlreIlqgTsneklrssfaeimavlw s ++++V+kAT+++ +gpk+khl++++q+T++++ + +++++++l+ KIAA0656 25 SAVARAVCKATTHEVMGPKKKHLDYLIQATNETN--VNIPQMADTLF 69 rRLndkgknWrvvyKaLillhyLlrnGspfervvlealrnrnrIltLsdf +R +++ +W+vv+KaL+++h+L+ +G+ ++++++l++rn++++Ls+f KIAA0656 70 ERATNS--SWVVVFKALVTTHHLMVHGN---ERFIQYLASRNTLFNLSNF 114 qdkvfndidsrgkDqGaniRtyakyLlelledderlkeer<-* dk ++s+g+D++ +iR+y++yL+e++ ++++++++ KIAA0656 115 LDK----SGSHGYDMSTFIRRYSRYLNEKAFSYRQMAFDF 150 //