hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-08593805/chunk_1/iprscan-20080502-08593805.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0645 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00049 78.5 8.2e-19 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00049 1/1 1162 1237 .. 1 90 [] 78.5 8.2e-19 Alignments of top-scoring domains: SM00049: domain 1 of 1, from 1162 to 1237: score 78.5, E = 8.2e-19 *->pesglklddrkyflktypncFtGselVdWLldnlegqsnngptkttf p++g++l +++ + p+cF+ +e+V+WL++++eg KIAA0645 1162 PSTGVQLL--SEQKGLSPYCFISAEVVHWLVNHVEG----------- 1195 iidreeAvhlgqaLlkeGlihhvndpnkhtFkdsknalYrFtd<-* i++ ++A+ ++q++l+e li h++++ ++tF ++ ++Y++ + KIAA0645 1196 IQTQAMAIDIMQKMLEEQLITHASGEAWRTFIYG-FYFYKIVT 1237 //