hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-08412441/chunk_1/iprscan-20080502-08412441.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0634 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00457 200.4 1.7e-55 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00457 1/1 833 1017 .. 1 232 [] 200.4 1.7e-55 Alignments of top-scoring domains: SM00457: domain 1 of 1, from 833 to 1017: score 200.4, E = 1.7e-55 *->qflvardtVrvrlytvkldesdlplaleFlkalrdLpdqynsanspd +++v++++Vr++ly+vkl +++la++F+++l+ L+++ +++ KIAA0634 833 YPMVQQWRVRSNLYRVKLS--TITLAAGFTNVLKILTKESSRE---- 873 qayarfiddYGTHYitSatlGGeyslllvldkeslerkgwltsediskcl ++ fi++YG HYi++a +G e++++++++++++++++wl++++++++l KIAA0634 874 -ELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTEL 922 ngeakvelassnlvagsvsaemkhctqssssskslstresqtvrlshtqv + ++ + + + + +++ l t + +ls++q KIAA0634 923 G--------------SKKELK---SMPFITYLSGLLTAQ----MLSDDQL 951 lGGaseaievledlergrkgclqsnsldfseWaesvpneaPvlidvksla + G +e+++ +e+gr c+++++l+++ +e++ + Pvl++++++ KIAA0634 952 ISG----VEIRC-EEKGR--CPSTCHLCRRPGKEQLSPT-PVLLEINRVV 993 PiyeLlpespfpvlvaleaspkreaLrqAlesYlk<-* P+y+L++++ ++ea++ Al+s+++ KIAA0634 994 PLYTLIQDN-----------GTKEAFKSALMSSYW 1017 //