hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-07590836/chunk_1/iprscan-20080502-07590836.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0610 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00745 94.1 1.6e-23 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00745 1/1 36 114 .. 1 81 [] 94.1 1.6e-23 Alignments of top-scoring domains: SM00745: domain 1 of 1, from 36 to 114: score 94.1, E = 1.6e-23 *->trdylqkAieliskAlkaDedvagdyeeAlelYkkgieyLlqgikve +r +++kA+ +++k+l +De g++eeA ++Yk+gi++Ll+gi+ KIAA0610 36 IREAYKKAFLFVNKGLNTDE--LGQKEEAKNYYKQGIGHLLRGISIS 80 kpsekrrealkakareYldRAeeikkylderlkp<-* ++++++++ +++ar+++++++e+++++++rl KIAA0610 81 SKESEHTGPGWESARQMQQKMKETLQNVRTRLEI 114 //