hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-06193139/chunk_1/iprscan-20080502-06193139.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0554 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00055 86.1 4.1e-21 1 SM00326 69.1 5.6e-16 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00055 1/1 58 151 .. 1 103 [] 86.1 4.1e-21 SM00326 1/1 610 667 .. 1 58 [] 69.1 5.6e-16 Alignments of top-scoring domains: SM00055: domain 1 of 1, from 58 to 151: score 86.1, E = 4.1e-21 *->mgfwselwsddGfeaLlsrlknglrlledlkkflreRakiEeeYAkk m+++ el +d+f+ L++++++g+ le ++kf++eR +iE +YAk+ KIAA0554 58 MSWGTEL--WDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQ 102 Lqklskkyfnkkssvgdlravreteselgslkkswevllsetdalakshl L lskky++kk ++ e e ++ s k++ + l e+++ a +h+ KIAA0554 103 LRNLSKKYQPKK------NSKEEEEYKYTSC-KAFISNLNEMNDYAGQHE 145 qlsedL<-* +se+ KIAA0554 146 VISENM 151 SM00326: domain 1 of 1, from 610 to 667: score 69.1, E = 5.6e-16 *->eyvvAlYDyeaqnedELsFkkGDiitvleks.ddgWweGelnrtGke ++++AlY +e+qne+ +s+ +G++++v+e++++dgW + ++n +e KIAA0554 610 GTCKALYTFEGQNEGTISVVEGETLYVIEEDkGDGWTRIRRN-EDEE 655 GlfPsnYVeeie<-* G++P++YVe++ KIAA0554 656 GYVPTSYVEVCL 667 //