hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-03282131/chunk_1/iprscan-20080502-03282131.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0454 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF07989.2.fs Microtubule associated 137.2 4.1e-38 4 PF07989.2.ls Microtubule associated 133.3 6.2e-37 1 PF06758.4.fs Repeat of unknown function (DUF1220) 127.1 6.6e-37 1 PF06758.4.ls Repeat of unknown function (DUF1220) 129.1 1.1e-35 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF07989.2.fs 1/4 137 199 .. 1 63 [] 131.3 2.5e-36 PF07989.2.ls 1/1 137 199 .. 1 63 [] 133.3 6.2e-37 PF06758.4.fs 1/1 1568 1638 .. 1 71 [] 127.1 6.6e-37 PF06758.4.ls 1/1 1568 1638 .. 1 71 [] 129.1 1.1e-35 Alignments of top-scoring domains: PF07989.2.fs: domain 1 of 4, from 137 to 199: score 131.3, E = 2.5e-36 *->LkKENFgLKLkIyFLeErLnkkseegiediiKeNiELKvevesLqRd LkKENF+LKL+IyFLeEr+++k+e+++edi+K+NiELKvevesL+R+ KIAA0454 137 LKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRE 183 lqgykkklsklekqle<-* lq++k++l+k+++++e KIAA0454 184 LQDKKQHLDKTWADVE 199 PF07989.2.ls: domain 1 of 1, from 137 to 199: score 133.3, E = 6.2e-37 *->LkKENFgLKLkIyFLeErLnkkseegiediiKeNiELKvevesLqRd LkKENF+LKL+IyFLeEr+++k+e+++edi+K+NiELKvevesL+R+ KIAA0454 137 LKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRE 183 lqgykkklsklekqle<-* lq++k++l+k+++++e KIAA0454 184 LQDKKQHLDKTWADVE 199 PF06758.4.fs: domain 1 of 1, from 1568 to 1638: score 127.1, E = 6.6e-37 *->EedqaGleppaPRLsreLqeaeEpiEVLQDSLDrcysTpSsshelpD E+dqaGlep+a+RLsreLqe+e++iEVLQ++LD++++TpSssh+l+D KIAA0454 1568 EKDQAGLEPLALRLSRELQEKEKVIEVLQAKLDARSLTPSSSHALSD 1614 SnQpYsstfyslEEqkvglaLDid<-* S++++sst+++++E ++++++Di+ KIAA0454 1615 SHRSPSSTSFLSDELEACSDMDIV 1638 PF06758.4.ls: domain 1 of 1, from 1568 to 1638: score 129.1, E = 1.1e-35 *->EedqaGleppaPRLsreLqeaeEpiEVLQDSLDrcysTpSsshelpD E+dqaGlep+a+RLsreLqe+e++iEVLQ++LD++++TpSssh+l+D KIAA0454 1568 EKDQAGLEPLALRLSRELQEKEKVIEVLQAKLDARSLTPSSSHALSD 1614 SnQpYsstfyslEEqkvglaLDid<-* S++++sst+++++E ++++++Di+ KIAA0454 1615 SHRSPSSTSFLSDELEACSDMDIV 1638 //