hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-02153931/chunk_1/iprscan-20080502-02153931.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0411 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00324 243.6 1.6e-68 1 SM00055 69.2 5.3e-16 1 SM00326 64.4 1.4e-14 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00055 1/1 8 106 .. 1 103 [] 69.2 5.3e-16 SM00324 1/1 479 653 .. 1 193 [] 243.6 1.6e-68 SM00326 1/1 709 764 .. 1 58 [] 64.4 1.4e-14 Alignments of top-scoring domains: SM00055: domain 1 of 1, from 8 to 106: score 69.2, E = 5.3e-16 *->mgfwselwsddGfeaLlsrlknglrlledlkkflreRakiEeeYAkk ++++ +l +++f++L+++ ++ l+ll+dl++f+r++a+iE eY+++ KIAA0411 8 KEIRTQL--VEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRS 52 Lqklskkyfnkkssvgdlravreteselgslkkswevllsetdalakshl L kl++++++k + +++++++ l+++ ++w +l++t+++++ h KIAA0411 53 LEKLAERFSSKIR-SSREHQFKKDQYLLSPV-NCWYLVLHQTRRESRDHA 100 qlsedL<-* +l + + KIAA0411 101 TLNDIF 106 SM00324: domain 1 of 1, from 479 to 653: score 243.6, E = 1.6e-68 *->spiPiivekCieylekrGldteGIYRvsGsksrvkeLreafdsged. + iP++ve+Ci+y+ +Gl+++GI+Rv+Gs+ +v+ ++++f++ged+ KIAA0411 479 QAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDp 525 dldsldesiteesedleeydvhdvAglLKlyLReLPePLltfelyeefie + d +e+d+++vAg+LKly+R L +PL+++e ++++i+ KIAA0411 526 L-----------VDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDLIS 564 aaklyqieatsrkqseksedeeerlralrellslLPpanratLryLl.HL +kl e++ er+++++++l +LP++ ++ryL+ +L KIAA0411 565 TIKL--------------ENPAERVHQIQQILVTLPRVVIVVMRYLFaFL 600 nrVaehsevNkMtarNLAivFgPtLlrpp.....ltdikhqnkvvetlie n+++++s++N+M++ NLAi+FgPtL++ p++++++++ +h+n+v++t+i KIAA0411 601 NHLSQYSDENMMDPYNLAICFGPTLMHIPdgqdpVSCQAHINEVIKTIII 650 nad<-* +++ KIAA0411 651 HHE 653 SM00326: domain 1 of 1, from 709 to 764: score 64.4, E = 1.4e-14 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG +++A++Dy ++++ ELsFkkG +++ + +++WweG++n G G KIAA0411 709 IEAIAKFDYMGRSPRELSFKKGASLLLYHRASEDWWEGRHN--GVDG 753 lfPsnYVeeie<-* l+P+ Y+ +++ KIAA0411 754 LIPHQYIVVQD 764 //