hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-00074436/chunk_1/iprscan-20080502-00074436.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0336 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01465.10.fs GRIP domain 71.0 3.7e-20 1 PF01465.10.ls GRIP domain 73.0 9.1e-19 1 PF00170.11.fs bZIP transcription factor 32.2 1.7e-08 10 PF02370.7.ls M protein repeat 33.7 6e-07 9 PF02370.7.fs M protein repeat 23.1 5.4e-05 7 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01465.10.fs 1/1 1563 1608 .. 1 46 [] 71.0 3.7e-20 PF01465.10.ls 1/1 1563 1608 .. 1 46 [] 73.0 9.1e-19 Alignments of top-scoring domains: PF01465.10.fs: domain 1 of 1, from 1563 to 1608: score 71.0, E = 3.7e-20 *->eganleYLKNVllqFLeskeseerkqLLpVistlLqFspeEkqkll< ++anleYLKNVllqF+ k er++LLpVi+t+Lq+speEk kl KIAA0336 1563 SAANLEYLKNVLLQFIFLKPGSERERLLPVINTMLQLSPEEKGKLA 1608 -* KIAA0336 - - PF01465.10.ls: domain 1 of 1, from 1563 to 1608: score 73.0, E = 9.1e-19 *->eganleYLKNVllqFLeskeseerkqLLpVistlLqFspeEkqkll< ++anleYLKNVllqF+ k er++LLpVi+t+Lq+speEk kl KIAA0336 1563 SAANLEYLKNVLLQFIFLKPGSERERLLPVINTMLQLSPEEKGKLA 1608 -* KIAA0336 - - //