hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-23393275/chunk_1/iprscan-20080501-23393275.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0321 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01363.12.ls FYVE zinc finger 105.3 1.7e-28 1 PF01363.12.fs FYVE zinc finger 103.4 6.1e-28 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01363.12.fs 1/1 810 876 .. 1 77 [] 103.4 6.1e-28 PF01363.12.ls 1/1 810 876 .. 1 77 [] 105.3 1.7e-28 Alignments of top-scoring domains: PF01363.12.fs: domain 1 of 1, from 810 to 876: score 103.4, E = 6.1e-28 *->phWvpDeevsnCmrCgkpFtkltkRrHHCRaCGrifCgsCssktvll ++WvpDe++s+Cm+C+++++++++RrHHCR CGr++C+sCs k++ + KIAA0321 810 HQWVPDETESICMVCCREHFTMFNRRHHCRRCGRLVCSSCSTKKMVV 856 pylgiaallkndviekpvRVCdsCydrlnk<-* + ++ e+p+RVCd+Cy+++nk KIAA0321 857 EGCR----------ENPARVCDQCYSYCNK 876 PF01363.12.ls: domain 1 of 1, from 810 to 876: score 105.3, E = 1.7e-28 *->phWvpDeevsnCmrCgkpFtkltkRrHHCRaCGrifCgsCssktvll ++WvpDe++s+Cm+C+++++++++RrHHCR CGr++C+sCs k++ + KIAA0321 810 HQWVPDETESICMVCCREHFTMFNRRHHCRRCGRLVCSSCSTKKMVV 856 pylgiaallkndviekpvRVCdsCydrlnk<-* + ++ e+p+RVCd+Cy+++nk KIAA0321 857 EGCR----------ENPARVCDQCYSYCNK 876 //