hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-23130622/chunk_1/iprscan-20080501-23130622.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0307 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00091 86.6 3.1e-21 2 SM00353 58.1 1.1e-12 1 SM00086 31.1 0.00016 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00353 1/1 68 121 .. 1 61 [] 58.1 1.1e-12 SM00091 1/2 136 203 .. 1 68 [] 44.2 1.8e-08 SM00091 2/2 324 390 .. 1 68 [] 42.4 6.1e-08 SM00086 1/1 397 440 .. 1 43 [] 31.1 0.00016 Alignments of top-scoring domains: SM00353: domain 1 of 1, from 68 to 121: score 58.1, E = 1.1e-12 *->narERrlrRRekiNeqafdeLrslvPtlpkgggnskKlsKasiLrlA +++ER r R+k+ + ++ eL+++vPt+ + +K++K++iLr+A KIAA0307 68 SEIER--RKRNKMTQ-YITELSDMVPTCS---ALARKPDKLTILRMA 108 ieYIrksLqeqlqe<-* ++++ ks++ + KIAA0307 109 VSHM-KSMRGTGNK 121 SM00091: domain 1 of 2, from 136 to 203: score 44.2, E = 1.8e-08 *->erlraileslpdgiivld.ldGrilyaNpaaeellGyspeeliGksl e + ile+++ +++v+ ++Gr++y++++++ l++++ e+ G +l KIAA0307 136 ELKHLILEAADGFLFVVAaETGRVIYVSDSVTPVLNQPQSEWFGSTL 182 lelihpedrlleevqe.lqrlla<-* +e +hp+d e ++e+l ++ + KIAA0307 183 YEQVHPDDV--EKLREqLCTSEN 203 SM00091: domain 2 of 2, from 324 to 390: score 42.4, E = 6.1e-08 *->erlraileslpdgiivldldGrilyaNpaaeellGyspeeliGksll + + + +++ +++ dG i++++p++ Gy p++l+Gk++l KIAA0307 324 CMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLGKDIL 370 elihpedrlleevqe.lqrlla<-* e++hped+ +++e++q++++ KIAA0307 371 EFCHPEDQ--SHLREsFQQVVK 390 SM00086: domain 1 of 1, from 397 to 440: score 31.1, E = 0.00016 *->tveyrlrrkdGsliwvlvsaspird.edgevegilgvvrDITer<-* +v yr+r+k+ ++ +++s + ++ ++e+e+i+++++++ + KIAA0307 397 SVMYRFRTKNREWMLIRTSSFTFQNpYSDEIEYIICTNTNVKQL 440 //