hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080501/iprscan-20080501-23093127/chunk_1/iprscan-20080501-23093127.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: KIAA0305
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00064                                                 119.3    4.4e-31   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00064    1/1     747   814 ..     1    81 []   119.3  4.4e-31

Alignments of top-scoring domains:
SM00064: domain 1 of 1, from 747 to 814: score 119.3, E = 4.4e-31
                   *->etaphWvpDeeasnClmnCgkeFtlvtrRrHHCRnCGrifCskCssk
                      ++ p+WvpD+ea nC mnC+++Ft+ t+RrHHCR+CG++fC+ C+++
    KIAA0305   747    QKQPTWVPDSEAPNC-MNCQVKFTF-TKRRHHCRACGKVFCGVCCNR 791  

                   kaplpklgkekkngknedftpvRVCdsCyerlsk<-*
                   k++l++l+k            +RVC +Cye++sk   
    KIAA0305   792 KCKLQYLEK-----------EARVCVVCYETISK    814  

//