hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-23093127/chunk_1/iprscan-20080501-23093127.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0305 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01363.12.ls FYVE zinc finger 124.9 2.1e-34 1 PF01363.12.fs FYVE zinc finger 123.1 7.3e-34 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01363.12.fs 1/1 750 814 .. 1 77 [] 123.1 7.3e-34 PF01363.12.ls 1/1 750 814 .. 1 77 [] 124.9 2.1e-34 Alignments of top-scoring domains: PF01363.12.fs: domain 1 of 1, from 750 to 814: score 123.1, E = 7.3e-34 *->phWvpDeevsnCmrCgkpFtkltkRrHHCRaCGrifCgsCssktvll p+WvpD+e+ nCm+C+++Ft +tkRrHHCRaCG++fCg C+++++ l KIAA0305 750 PTWVPDSEAPNCMNCQVKFT-FTKRRHHCRACGKVFCGVCCNRKCKL 795 pylgiaallkndviekpvRVCdsCydrlnk<-* +yl ek++RVC +Cy+ +k KIAA0305 796 QYL-----------EKEARVCVVCYETISK 814 PF01363.12.ls: domain 1 of 1, from 750 to 814: score 124.9, E = 2.1e-34 *->phWvpDeevsnCmrCgkpFtkltkRrHHCRaCGrifCgsCssktvll p+WvpD+e+ nCm+C+++Ft +tkRrHHCRaCG++fCg C+++++ l KIAA0305 750 PTWVPDSEAPNCMNCQVKFT-FTKRRHHCRACGKVFCGVCCNRKCKL 795 pylgiaallkndviekpvRVCdsCydrlnk<-* +yl ek++RVC +Cy+ +k KIAA0305 796 QYL-----------EKEARVCVVCYETISK 814 //