hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-22565327/chunk_1/iprscan-20080501-22565327.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0299 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF06920.3.ls Dedicator of cytokinesis 10.1 2.5e-08 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF06920.3.ls 1/1 1320 1507 .. 1 190 [] 10.1 2.5e-08 Alignments of top-scoring domains: PF06920.3.ls: domain 1 of 1, from 1320 to 1507: score 10.1, E = 2.5e-08 *->TyFernhnlrRFmFeTPFTktGraq.GeleEQfKRkTILttensFPy F r +n+r F ++ PF k + ++ e + +T Lt +s P KIAA0299 1320 KSFYRVNNVRKFRYDRPFHKGPKDKeNEFKSLWIERTTLTLTHSLPG 1366 iktRilViskeeieLsPIEVAIediqKKtaeLaaainqppssEGDqLpdl i V +e e sP E+AI + K++eL+ +i+q + KIAA0299 1367 ISRWFEVERRELVEVSPLENAIQVVENKNQELRSLISQYQ--HKQVHGNI 1414 KmLQmvLQGSVgvtVNaGPLevAraFLanepadrlGrPpdrhvnkLrlvF L+m L G + + VN G + aF + + + ++ +L++ KIAA0299 1415 NLLSMCLNGVIDAAVNGGIARYQEAFFDKDYINKH-PGDAEKITQLKELM 1463 reFikrCkrALevNkrLIgeDQkEYqreLeeNYekLkeeLsplI<-* e + + + L+v++ ++ + ++ L ++ +++ L + KIAA0299 1464 QEQVHVLGVGLAVHEKFVHPEMRPLHKKLIDQFQMMRASLYHEF 1507 //