hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-22400486/chunk_1/iprscan-20080501-22400486.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0289 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00457 207.5 1.2e-57 1 SM00181 35.0 1e-05 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00181 1/3 470 507 .. 1 32 [] 15.9 5.6 SM00181 2/3 611 652 .. 1 32 [] 10.4 31 SM00181 3/3 659 708 .. 1 32 [] 8.6 44 SM00457 1/1 811 999 .. 1 232 [] 207.5 1.2e-57 Alignments of top-scoring domains: SM00181: domain 1 of 3, from 470 to 507: score 15.9, E = 5.6 *->eCa.....pCsnGgtEqnGtCi..sytC.CpgpGytg......rCe< Ca++ +pC++ +C +++ +C C +Gy+ ++ +++ C+ KIAA0289 470 LCArrlldPCEH-------QCDpeTGEClCY-EGYMKdpvhkhLCI 507 -* KIAA0289 - - SM00181: domain 2 of 3, from 611 to 652: score 10.4, E = 31 *->eCa....pCsnGgtEqnGtCi......sytC.CpgpGytg.....rC +C++++++Cs + +Ci++++ +s C Cp G + ++++ C KIAA0289 611 DCSkdngGCSKNF-----RCIsdrkldSTGCvCP-SGLSPmkdssGC 651 e<-* KIAA0289 652 Y 652 SM00181: domain 3 of 3, from 659 to 708: score 8.6, E = 44 *->eCa.....pCsnGgtEqnGtCi...............sytC.CpgpG +C+++ +++C++ C+ + +++++ + C+C + KIAA0289 659 DCSdgfngGCEQ-------LCLqqmapfpddptlyniLMFCgCI-ED 697 ytg.....rCe<-* y+++ ++++C+ KIAA0289 698 YKLgvdgrSCQ 708 SM00457: domain 1 of 1, from 811 to 999: score 207.5, E = 1.2e-57 *->qflvardtVrvrlytvkldesdlplaleFlkalrdLpdqynsanspd ++++++++Vr+++y++kl+ ++ +++ + +al++L +++a KIAA0289 811 YPVLQHWKVRSVMYHIKLN--QVAISQALSNALHSLDGATSRA---- 851 qayarfiddYGTHYitSatlGGeyslllvldkeslerkgwltsediskcl ++++++d++G+HYi++a +G+e+s+ +++++++++r++wl++edisk++ KIAA0289 852 -DFVALLDQFGNHYIQEAIYGFEESCSIWYPNKQVQRRLWLEYEDISKGN 900 ngeakvelassnlvagsvsaemkhctqssssskslstresqtvrlshtqv ++++++e +++ +++ ++++ ++++sls++ ++++ KIAA0289 901 SPSDESE-------ERERDPK---VLTFPEYITSLSDSG-------TKRM 933 lGGaseaievledlergrkgclqsnsldfseWaesvpneaPvlidvksla + G +++++ +++gr c++s++l++++++ ++p+e Pvl++v+++a KIAA0289 934 AAG----VRMEC-QSKGR--CPSSCPLCHVTSSPDTPAE-PVLLEVTKAA 975 PiyeLlpespfpvlvaleaspkreaLrqAlesYlk<-* PiyeL++++ ++++ L++A++s+l+ KIAA0289 976 PIYELVTNN-----------QTQRLLQEATMSSLW 999 //