hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-21125147/chunk_1/iprscan-20080501-21125147.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0239 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00628.19.fs PHD-finger 62.0 1.8e-19 2 PF00628.19.ls PHD-finger 58.9 1.5e-14 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00628.19.fs 1/2 260 308 .. 1 51 [] 57.0 7.1e-18 PF00628.19.ls 1/1 260 308 .. 1 51 [] 58.9 1.5e-14 Alignments of top-scoring domains: PF00628.19.fs: domain 1 of 2, from 260 to 308: score 57.0, E = 7.1e-18 *->yCsvCgkeysdaggdllqCDgCdrwfHlaClgpplepeeipeWyCpe C+vC++++ ++g+++++CD+C++++H+aC+g+ p++ W+C+ KIAA0239 260 VCDVCRSPEGEDGNEMVFCDKCNVCVHQACYGILKVPTGS--WLCRT 304 Ckpk<-* C + KIAA0239 305 CALG 308 PF00628.19.ls: domain 1 of 1, from 260 to 308: score 58.9, E = 1.5e-14 *->yCsvCgkeysdaggdllqCDgCdrwfHlaClgpplepeeipeWyCpe C+vC++++ ++g+++++CD+C++++H+aC+g+ p++ W+C+ KIAA0239 260 VCDVCRSPEGEDGNEMVFCDKCNVCVHQACYGILKVPTGS--WLCRT 304 Ckpk<-* C + KIAA0239 305 CALG 308 //