hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-20542079/chunk_1/iprscan-20080501-20542079.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0228 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00028 32.5 5.8e-05 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00028 1/3 342 375 .. 1 34 [] 2.3 2.7e+02 SM00028 2/3 525 558 .. 1 34 [] 28.0 0.0013 SM00028 3/3 567 601 .. 1 34 [] 2.2 2.9e+02 Alignments of top-scoring domains: SM00028: domain 1 of 3, from 342 to 375: score 2.3, E = 2.7e+02 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* +++l + a+ + ++++A++ + A+ l++++ KIAA0228 342 VDVLRQASKACVVKREFKKAEQLIKHAVYLARDH 375 SM00028: domain 2 of 3, from 525 to 558: score 28.0, E = 0.0013 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* a+ + nlG +y ++ +++eA+e kA+++ ++ KIAA0228 525 AKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQL 558 SM00028: domain 3 of 3, from 567 to 601: score 2.2, E = 2.9e+02 *->aealynlGnay.lklgdydeAieyyekALeldPnn<-* a l+ +y++ +++y+ A++ y +++++ + KIAA0228 567 ALSVGHLASLYnYDMNQYENAEKLYLRSIAIGKKL 601 //