hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-19461847/chunk_1/iprscan-20080501-19461847.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0187 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00785 168.9 4.9e-46 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00785 1/1 234 320 .. 1 89 [] 168.9 4.9e-46 Alignments of top-scoring domains: SM00785: domain 1 of 1, from 234 to 320: score 168.9, E = 4.9e-46 *->EilnLlRflsvmkprplsWRdqHpYlLadrveditnpeelieedpkv Ei+nL Rf+ vmk+rpl+W+ +HpY+Ladr+ed+tnpe+ i+++ k+ KIAA0187 234 EIHNLGRFITVMKFRPLTWQTSHPYILADRMEDLTNPED-IRTNIKC 279 drkklvvyGyVRGtgLnanrlVHIPGlGDFqiskIealpDPc<-* drk + +yGy+RG +L+ + ++H PG+GDF +s+I++lpDPc KIAA0187 280 DRK-VSLYGYLRGAHLKNKSQIHMPGVGDFAVSDISFLPDPC 320 //