hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-19033002/chunk_1/iprscan-20080501-19033002.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0161 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00647 85.9 5e-21 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00647 1/2 125 190 .. 1 78 [] 80.3 2.3e-19 SM00647 2/2 202 266 .. 1 78 [] 5.5 0.46 Alignments of top-scoring domains: SM00647: domain 1 of 2, from 125 to 190: score 80.3, E = 2.3e-19 *->ekYerlllesyvesnpdlkwCPapdCsaairvtelstsrsaisgasd ++Y++l +e++v +p ++wCPa+ C+a+++ ++ + KIAA0161 125 QRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVG----------- 160 eegcnrvtCprkCgfsFCfrCkvewHspvsC<-* + +++v+C+ +C+ +FC+ Ck+ wH+++ C KIAA0161 161 LQTPQPVQCK-ACRMEFCSTCKASWHPGQGC 190 SM00647: domain 2 of 2, from 202 to 266: score 5.5, E = 0.46 *->ekYerlllesyvesnpdlkwCPapdCsaairvtelstsrsaisgasd e + e+++ +k CP +C ++++ KIAA0161 202 ---ETSAAFKMEEDDAPIKRCP--KC-KVYIER-------------- 228 eegcnrvtCprkCgfsFCfrCkvew.......Hspv.sC<-* +egc ++ C+ C+++FC+ C++ +++ H++ + C KIAA0161 229 DEGCAQMMCK-NCKHAFCWYCLESLdddflliHYDKgPC 266 //