hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-18264119/chunk_1/iprscan-20080501-18264119.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0139 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00088 75.3 7.6e-18 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00088 1/1 432 512 .. 1 92 [] 75.3 7.6e-18 Alignments of top-scoring domains: SM00088: domain 1 of 1, from 432 to 512: score 75.3, E = 7.6e-18 *->qhverLqrkiretnllqlsepYPssislsdlakllglsvpeevEklv q+v++Lq++ +++ l+q+s++Y +si++s+l +l+++ ++++E+ + KIAA0139 432 QYVPQLQNNTILRLLQQVSQIY-QSIEFSRLTSLVPFVDAFQLERAI 477 skaIrdgeisakIDqvngivefeevdpryltsnqlaqlaerlkkl<-* ++a r++ ++ +ID+ +++++f+++ ++a+r ++ KIAA0139 478 VDAARHCDLQVRIDHTSRTLSFGSD----------LNYATREDAP 512 //