hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/TIGRFAMs_HMM.LIB.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-18201254/chunk_1/iprscan-20080501-18201254.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0135 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TIGR00229 sensory_box: PAS domain S-box 25.7 5.5e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TIGR00229 1/1 138 265 .. 1 130 [] 25.7 5.5e-05 Alignments of top-scoring domains: TIGR00229: domain 1 of 1, from 138 to 265: score 25.7, E = 5.5e-05 *->reseeryraifesspdaiivvdleGn.ilyvnpafeelfGysaeell s ++ a + + + ai++vd + ++il +n++++ l+Gys+++l+ KIAA0135 138 GWSSPLLPAPVCNPNKAIFTVDAKTTeILVANDKACGLLGYSSQDLI 184 GrnvlelipeedreelrerierlletgerepvseerrvlgrrkdGseiwv G+++++++ d ++++++ e++ e+ ++ v + v +++ G++i+v KIAA0135 185 GQKLTQFFLRSDSDVVEALSEEHMEADGHAAVVFGTVVDIITRSGEKIPV 234 evsvspirdsnggvlgvlgivrDiterkeaeeal<-* v ++r ++++ +v + er+ + a+ KIAA0135 235 SVWMKRMR---QERRLCCVVVLEPVERVSTWVAF 265 //