hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-18132020/chunk_1/iprscan-20080501-18132020.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0131 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00324 231.0 1e-64 1 SM00055 96.0 4.4e-24 1 SM00326 76.3 3.8e-18 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00055 1/1 18 120 .. 1 103 [] 96.0 4.4e-24 SM00324 1/1 514 688 .. 1 193 [] 231.0 1e-64 SM00326 1/1 745 800 .. 1 58 [] 76.3 3.8e-18 Alignments of top-scoring domains: SM00055: domain 1 of 1, from 18 to 120: score 96.0, E = 4.4e-24 *->mgfwselwsddGfeaLlsrlknglrlledlkkflreRakiEeeYAkk ++++++l +++++L+ + + ++ll++l++f+r+Ra++E eY+++ KIAA0131 18 KEMRWQL--SEQLRCLELQGELRRELLQELAEFMRRRAEVELEYSRG 62 Lqklskkyfnkks...svgdlravreteselgslkkswevllsetdalak L kl++++++++++ +s+++++++r+ +s l++l ++w+vll++t+++++ KIAA0131 63 LEKLAERFSSRGGrlgSSREHQSFRKEPSLLSPL-HCWAVLLQHTRQQSR 111 shlqlsedL<-* lse L KIAA0131 112 ESAALSEVL 120 SM00324: domain 1 of 1, from 514 to 688: score 231.0, E = 1e-64 *->spiPiivekCieylekrGldteGIYRvsGsksrvkeLreafdsged. +p+P++ve+Ci+++ +Gl+ eGI+RvsG + rv e+r+af++ged+ KIAA0131 514 QPVPLVVESCIRFINLNGLQHEGIFRVSGAQLRVSEIRDAFERGEDp 560 dldsldesiteesedleeydvhdvAglLKlyLReLPePLltfelyeefie +e + +d +vAg+LKly+R+L PL++++l++e++ KIAA0131 561 L-----------VEGCTAHDLDSVAGVLKLYFRSLEPPLFPPDLFGELLA 599 aaklyqieatsrkqseksedeeerlralrellslLPpanratLryLl.HL ++l e + er++++ +ll +LP + + +LryL+++L KIAA0131 600 SSEL--------------EATAERVEHVSRLLWRLPAPVLVVLRYLFtFL 635 nrVaehsevNkMtarNLAivFgPtLlrpp.....ltdikhqnkvvetlie n++a++s++N+M++ NLA++FgPtLl p +++++++ +n++v+tli+ KIAA0131 636 NHLAQYSDENMMDPYNLAVCFGPTLLPVPagqdpVALQGRVNQLVQTLIV 685 nad<-* ++d KIAA0131 686 QPD 688 SM00326: domain 1 of 1, from 745 to 800: score 76.3, E = 3.8e-18 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG +++vA ++y++++++ELsF++GD+++++e+ +++Ww+Ge+n G +G KIAA0131 745 VEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHN--GMRG 789 lfPsnYVeeie<-* l+P+ Y+++ KIAA0131 790 LIPHKYITLPA 800 //