hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-18064928/chunk_1/iprscan-20080501-18064928.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0127 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF06031.4.fs SERTA motif 80.1 2e-22 1 PF06031.4.ls SERTA motif 82.1 1.6e-21 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF06031.4.fs 1/1 41 78 .. 1 38 [] 80.1 2e-22 PF06031.4.ls 1/1 41 78 .. 1 38 [] 82.1 1.6e-21 Alignments of top-scoring domains: PF06031.4.fs: domain 1 of 1, from 41 to 78: score 80.1, E = 2e-22 *->iLdlSlvKLqrirdlsEpsLrRsVLInNTLrRIqeEle<-* i+++Sl+KL+++r+l+EpsL+++VLInN+LrRIqeEl+ KIAA0127 41 IFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELK 78 PF06031.4.ls: domain 1 of 1, from 41 to 78: score 82.1, E = 1.6e-21 *->iLdlSlvKLqrirdlsEpsLrRsVLInNTLrRIqeEle<-* i+++Sl+KL+++r+l+EpsL+++VLInN+LrRIqeEl+ KIAA0127 41 IFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELK 78 //