hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-18051150/chunk_1/iprscan-20080501-18051150.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0126 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF04564.6.fs U-box domain 171.7 1.7e-61 1 PF04564.6.ls U-box domain 173.6 4.5e-49 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF04564.6.fs 1/1 996 1070 .. 1 81 [] 171.7 1.7e-61 PF04564.6.ls 1/1 996 1070 .. 1 81 [] 173.6 4.5e-49 Alignments of top-scoring domains: PF04564.6.fs: domain 1 of 1, from 996 to 1070: score 171.7, E = 1.7e-61 *->DiPDEFlDPItleLMkDPVilPSGkityDRstIerHLlsEAWGvdpt D++DEFlDPI+++LM+DPV+lPS+++t+DRstI+rHLls d+t KIAA0126 996 DACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLS-----DQT 1037 DPftGRepLthdeLiPNleLKekIdawleekrea<-* DPf+ R+pLt+d++ PN eLKekI++wl+e++++ KIAA0126 1038 DPFN-RSPLTMDQIRPNTELKEKIQRWLAERKQQ 1070 PF04564.6.ls: domain 1 of 1, from 996 to 1070: score 173.6, E = 4.5e-49 *->DiPDEFlDPItleLMkDPVilPSGkityDRstIerHLlsEAWGvdpt D++DEFlDPI+++LM+DPV+lPS+++t+DRstI+rHLls d+t KIAA0126 996 DACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLS-----DQT 1037 DPftGRepLthdeLiPNleLKekIdawleekrea<-* DPf+ R+pLt+d++ PN eLKekI++wl+e++++ KIAA0126 1038 DPFN-RSPLTMDQIRPNTELKEKIQRWLAERKQQ 1070 //