hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-17340792/chunk_1/iprscan-20080501-17340792.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0107 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00088 96.9 2.4e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00088 1/1 298 381 .. 1 92 [] 96.9 2.4e-24 Alignments of top-scoring domains: SM00088: domain 1 of 1, from 298 to 381: score 96.9, E = 2.4e-24 *->qhverLqrkiretnllqlsepYPssislsdlakllglsvpeevEklv +h+++++r++r +++ ql+e+Y +s++l ++a+++g+ v++ ++ ++ KIAA0107 298 PHYRYYVREMRIHAYSQLLESY-RSLTLGYMAEAFGVGVEF-IDQEL 342 skaIrdgeisakIDqvngivefeevdpryltsnqlaqlaerlkkl<-* s++I++g++++kID vn ive++++d +++q++e++kk+ KIAA0107 343 SRFIAAGRLHCKIDKVNEIVETNRPDS------KNWQYQETIKKG 381 //