hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-16222440/chunk_1/iprscan-20080501-16222440.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0064 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00787.14.fs PX domain 97.0 4.2e-29 1 PF00787.14.ls PX domain 98.8 1.5e-26 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00787.14.fs 1/1 26 130 .. 1 131 [] 97.0 4.2e-29 PF00787.14.ls 1/1 26 130 .. 1 131 [] 98.8 1.5e-26 Alignments of top-scoring domains: PF00787.14.fs: domain 1 of 1, from 26 to 130: score 97.0, E = 4.2e-29 *->dpili.vvvvdpetsrkkegdkkhtyyvyevttktnkewsVkRRYsd ++++i+ +++++ s ++ +y++y++++++ +++ RYs+ KIAA0064 26 MHFSIpETESRSGDS------GGSAYVAYNIHVNG--VLHCRVRYSQ 64 FeeLhekLlrkfpgrilPplPpKklfgryrkeslpmtsvwhssnnfdeef + Lhe+L++++++ +lP +PpKklf+ + ++ KIAA0064 65 LLGLHEQLRKEYGANVLPAFPPKKLFS------------------LTPAE 96 iekRrkgLeeyLqrllqhPelsnesevvleFLesd<-* +e+Rr++Le+y+q + q+P+l + se + +FL KIAA0064 97 VEQRREQLEKYMQAVRQDPLLGS-SETFNSFLRRA 130 PF00787.14.ls: domain 1 of 1, from 26 to 130: score 98.8, E = 1.5e-26 *->dpili.vvvvdpetsrkkegdkkhtyyvyevttktnkewsVkRRYsd ++++i+ +++++ s ++ +y++y++++++ +++ RYs+ KIAA0064 26 MHFSIpETESRSGDS------GGSAYVAYNIHVNG--VLHCRVRYSQ 64 FeeLhekLlrkfpgrilPplPpKklfgryrkeslpmtsvwhssnnfdeef + Lhe+L++++++ +lP +PpKklf+ + ++ KIAA0064 65 LLGLHEQLRKEYGANVLPAFPPKKLFS------------------LTPAE 96 iekRrkgLeeyLqrllqhPelsnesevvleFLesd<-* +e+Rr++Le+y+q + q+P+l + se + +FL KIAA0064 97 VEQRREQLEKYMQAVRQDPLLGS-SETFNSFLRRA 130 //