hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-15230964/chunk_1/iprscan-20080501-15230964.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0029 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01424.13.fs R3H domain 67.9 3e-19 1 PF01424.13.ls R3H domain 69.8 8e-18 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01424.13.fs 1/1 134 187 .. 1 58 [] 67.9 3e-19 PF01424.13.ls 1/1 134 187 .. 1 58 [] 69.8 8e-18 Alignments of top-scoring domains: PF01424.13.fs: domain 1 of 1, from 134 to 187: score 67.9, E = 3e-19 *->eeeiadfvrvkstgksvflpPMtsyeRkliHqlaeefgdLeseSeGe e+ei+df + ++++ ++++pPMtsy+R+l+H++a++fg L ++++++ KIAA0029 134 EQEILDF-IGNNESPRKKFPPMTSYHRMLLHRVAAYFG-LDHNVDQS 178 gpkRrvviskk<-* g ++v+++k+ KIAA0029 179 G--KSVIVNKT 187 PF01424.13.ls: domain 1 of 1, from 134 to 187: score 69.8, E = 8e-18 *->eeeiadfvrvkstgksvflpPMtsyeRkliHqlaeefgdLeseSeGe e+ei+df + ++++ ++++pPMtsy+R+l+H++a++fg L ++++++ KIAA0029 134 EQEILDF-IGNNESPRKKFPPMTSYHRMLLHRVAAYFG-LDHNVDQS 178 gpkRrvviskk<-* g ++v+++k+ KIAA0029 179 G--KSVIVNKT 187 //