hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-14523948/chunk_1/iprscan-20080501-14523948.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0012 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00255 159.3 3.8e-43 1 SM00082 60.4 2.3e-13 1 SM00369 35.4 7.9e-06 4 SM00364 25.1 0.0097 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00369 1/4 71 94 .. 1 24 [] 12.4 13 SM00369 2/4 116 140 .. 1 24 [] 1.0 3.1e+02 SM00364 1/3 374 393 .. 1 20 [] 5.4 1.2e+02 SM00369 3/4 374 397 .. 1 24 [] 8.8 35 SM00364 2/3 447 466 .. 1 20 [] 5.6 1.2e+02 SM00364 3/3 470 489 .. 1 20 [] 14.2 8.7 SM00369 4/4 470 494 .. 1 24 [] 13.2 10 SM00082 1/1 527 581 .. 1 55 [] 60.4 2.3e-13 SM00255 1/1 639 782 .. 1 147 [] 159.3 3.8e-43 Alignments of top-scoring domains: SM00369: domain 1 of 4, from 71 to 94: score 12.4, E = 13 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++Lr L s+N ++ L +F KIAA0012 71 LSKLRILIISHNTIQYLDISVFKF 94 SM00369: domain 2 of 4, from 116 to 140: score 1.0, E = 3.1e+02 *->LpnLreLdLsnNqLtsLP..pgaFqg<-* +nL++LdLs+N++ +LP + F++ KIAA0012 116 TVNLKHLDLSFNAFDALPicKE-FGN 140 SM00364: domain 1 of 3, from 374 to 393: score 5.4, E = 1.2e+02 *->PpsLkeLnvsnNrLteLPeL<-* +L++L + N+L+eL+ KIAA0012 374 LTELETLILQMNQLKELSKI 393 SM00369: domain 3 of 4, from 374 to 397: score 8.8, E = 35 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++L++L L+ NqL++L a KIAA0012 374 LTELETLILQMNQLKELSKIAEMT 397 SM00364: domain 2 of 3, from 447 to 466: score 5.6, E = 1.2e+02 *->PpsLkeLnvsnNrLteLPeL<-* Pp++k L+ +N++++ P KIAA0012 447 PPRIKVLDLHSNKIKSIPKQ 466 SM00364: domain 3 of 3, from 470 to 489: score 14.2, E = 8.7 *->PpsLkeLnvsnNrLteLPeL<-* ++L+eLnv +N+Lt+LP KIAA0012 470 LEALQELNVAFNSLTDLPGC 489 SM00369: domain 4 of 4, from 470 to 494: score 13.2, E = 10 *->LpnLreLdLsnNqLtsLP.pgaFqg<-* L +L+eL+ +N Lt LP+ g F++ KIAA0012 470 LEALQELNVAFNSLTDLPgCGSFSS 494 SM00082: domain 1 of 1, from 527 to 581: score 60.4, E = 2.3e-13 *->NPfnCDCeLrwLlrwleaqnnealqdpvsslrCasPeslrGqpllll NPf C+CeL ++ +++++++e+l+++ +s++C++Pes+rG+ l ++ KIAA0012 527 NPFQCTCELGEFVKNIDQVSSEVLEGWPDSYKCDYPESYRGTLLKDF 573 lpsefsCp<-* ++se sC KIAA0012 574 HMSELSCN 581 SM00255: domain 1 of 1, from 639 to 782: score 159.3, E = 3.8e-43 *->eydvFiSfrg.deedvrnefvshLlkalrgkgklcvFiDdfepgggd ++ +FiS++g+d+ +v ne+++ L+k+ ++c+++++f+pg+++ KIAA0012 639 QFHAFISYSGhDSFWVKNELLPNLEKEGM---QICLHERNFVPGKSI 682 aenkllpelfeaIekSriaivvlSpnYaeSeWCldlElvaalecale.gg +en ++ +IekS ++i+vlSpn+++SeWC El +a+++ +++g+ KIAA0012 683 VEN-----IITCIEKSYKSIFVLSPNFVQSEWCHY-ELYFAHHNLFHeGS 726 lrvIPIfyevi..sdvrkqtgkfgkvfkkngpedtylkwted......fW +I+I +e+i+++ +++ k++ ++ ++ tyl+w++++++++ fW KIAA0012 727 NSLILILLEPIpqYSIPSSYHKLKSLMARR----TYLEWPKEkskrglFW 772 kkalysvpnk<-* ++++++ +k KIAA0012 773 ANLRAAINIK 782 //