Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC016501A_C01 KMC016501A_c01
(525 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_012438.1| Protein required for cell viability; Yjl097wp [... 35 0.41
>ref|NP_012438.1| Protein required for cell viability; Yjl097wp [Saccharomyces
cerevisiae] gi|731974|sp|P40857|YJJ7_YEAST Hypothetical
24.5 kDa protein in SAP185-BCK1 intergenic region
gi|1078243|pir||S50296 probable membrane protein YJL097w
- yeast (Saccharomyces cerevisiae)
gi|640006|emb|CAA54893.1| J0902 [Saccharomyces
cerevisiae] gi|1008274|emb|CAA89391.1| ORF YJL097w
[Saccharomyces cerevisiae]
Length = 217
Score = 35.4 bits (80), Expect = 0.41
Identities = 23/71 (32%), Positives = 39/71 (54%)
Frame = +1
Query: 265 IVLSWTGSDQTRILNFLWLQTLLLAGNSGY*SHILSTLRFTVWFALQSAGLKSERLILYC 444
++L+W+ T I+ +L+ +L+ N IL LR+ +++ L G+ SE I+YC
Sbjct: 108 LLLAWS---ITEIVRYLYYFFMLVFKNGA--PKILILLRYNLFWILYPTGVASELRIIYC 162
Query: 445 ELNNFYNIYSL 477
LN + YSL
Sbjct: 163 ALNAAESQYSL 173
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 404,800,350
Number of Sequences: 1393205
Number of extensions: 7479973
Number of successful extensions: 13026
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 12119
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13020
length of database: 448,689,247
effective HSP length: 115
effective length of database: 288,470,672
effective search space used: 17019769648
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)