Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC013964A_C01 KMC013964A_c01
(498 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_015365.1| SDF1 the first obserwed null phenotype was Spor... 31 6.7
>ref|NP_015365.1| SDF1 the first obserwed null phenotype was Sporulation DeFiciency;
Tip41p [Saccharomyces cerevisiae] gi|2132260|pir||S61061
hypothetical protein YPR040w - yeast (Saccharomyces
cerevisiae) gi|1072406|emb|CAA92144.1| unknown
[Saccharomyces cerevisiae] gi|1314112|emb|CAA94988.1|
unknown [Saccharomyces cerevisiae]
Length = 356
Score = 31.2 bits (69), Expect = 6.7
Identities = 19/58 (32%), Positives = 27/58 (45%), Gaps = 4/58 (6%)
Frame = +2
Query: 44 PPTHVKTNTNQP*CIHLITKVMVLKQAPSFTFRDNTSVIV----ISEWQ*PILAKDEL 205
PP H+ N N P C+H V++ + DN S+ + IS + PIL EL
Sbjct: 56 PPRHICNNPNNPQCLH-CGSVIIPSPRATLPLEDNPSISINDWTISSRKKPILNSQEL 112
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 385,560,354
Number of Sequences: 1393205
Number of extensions: 7140523
Number of successful extensions: 15997
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 15584
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15970
length of database: 448,689,247
effective HSP length: 114
effective length of database: 289,863,877
effective search space used: 14783057727
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
