Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC010801A_C01 KMC010801A_c01
(467 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_701750.1| 3-hydroxyisobutyryl-coenzyme A hydrolase, putat... 37 0.10
>ref|NP_701750.1| 3-hydroxyisobutyryl-coenzyme A hydrolase, putative [Plasmodium
falciparum 3D7] gi|23496922|gb|AAN36474.1|AE014850_39
3-hydroxyisobutyryl-coenzyme A hydrolase, putative
[Plasmodium falciparum 3D7]
Length = 541
Score = 37.0 bits (84), Expect = 0.10
Identities = 18/61 (29%), Positives = 30/61 (48%)
Frame = -1
Query: 341 CNYFIRSHFFREIKIHLGLESISTGIIVQVMISMWGWHVLNDCN*LSNFKGVKVQNQLGY 162
C YF R +F R I +HLGL S+ + + ++ ++ N + N +K NQ +
Sbjct: 320 CCYFFRKYFGRNIGLHLGLTSLRLNEVDLINFNVCNNYIENVDTFMDNLNNIKATNQEDF 379
Query: 161 N 159
N
Sbjct: 380 N 380
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 375,056,473
Number of Sequences: 1393205
Number of extensions: 7096536
Number of successful extensions: 13363
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 13151
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13363
length of database: 448,689,247
effective HSP length: 113
effective length of database: 291,257,082
effective search space used: 12232797444
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)