Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC005597A_C01 KMC005597A_c01
(562 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|EAA31125.1| hypothetical protein [Neurospora crassa] 34 1.4
>gb|EAA31125.1| hypothetical protein [Neurospora crassa]
Length = 1120
Score = 33.9 bits (76), Expect = 1.4
Identities = 14/34 (41%), Positives = 20/34 (58%)
Frame = +1
Query: 337 RQLHLLLTYYPKIQHYLTDCTVPGFFPGLSQCHS 438
R + LL +P I+H+ C +PG FPG+ HS
Sbjct: 748 RAVRNLLQKHPDIKHFQLGCCLPGIFPGIPLDHS 781
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 460,006,021
Number of Sequences: 1393205
Number of extensions: 9604602
Number of successful extensions: 19998
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 19494
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19993
length of database: 448,689,247
effective HSP length: 116
effective length of database: 287,077,467
effective search space used: 20095422690
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)