Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC004953A_C01 KMC004953A_c01
(355 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_043735.1| unknown [Allomyces macrogynus] gi|2147510|pir||... 30 7.8
>ref|NP_043735.1| unknown [Allomyces macrogynus] gi|2147510|pir||S63653 hypothetical
protein 176 - Allomyces macrogynus mitochondrion
gi|1236419|gb|AAC49236.1| OMEGA orf [Allomyces
macrogynus]
Length = 176
Score = 30.0 bits (66), Expect = 7.8
Identities = 13/32 (40%), Positives = 21/32 (65%)
Frame = -1
Query: 331 IYSFVRFGVSILDSNPHWTLYRRLL*KERKKL 236
+ F + G+S+L +NP +T Y L K+RKK+
Sbjct: 50 LQKFTQLGISLLLTNPLFTHYHDLFYKDRKKI 81
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 323,148,704
Number of Sequences: 1393205
Number of extensions: 6752831
Number of successful extensions: 13662
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 13435
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13657
length of database: 448,689,247
effective HSP length: 93
effective length of database: 319,121,182
effective search space used: 7658908368
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
