Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC004533A_C01 KMC004533A_c01
(822 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_505235.1| Predicted CDS, putative plasma membrane membran... 32 8.7
>ref|NP_505235.1| Predicted CDS, putative plasma membrane membrane protein, with at
least 11 transmembrane domains, nematode specific
[Caenorhabditis elegans] gi|7510625|pir||T33437
hypothetical protein ZC190.6 - Caenorhabditis elegans
gi|3329664|gb|AAC26966.1| Hypothetical protein ZC190.6
[Caenorhabditis elegans]
Length = 547
Score = 32.3 bits (72), Expect = 8.7
Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
Frame = -3
Query: 388 LKSRFEV-DIILACLTCLNVRCFSFIIIFSFIFFIWXLTT 272
L+ RF++ D+ + + V C +F+I F+F+ +W L+T
Sbjct: 428 LEKRFQISDVYIWTQAIIPVACIAFLIHFTFVIVVWLLST 467
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 659,114,812
Number of Sequences: 1393205
Number of extensions: 14198572
Number of successful extensions: 28926
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 27753
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28908
length of database: 448,689,247
effective HSP length: 121
effective length of database: 280,111,442
effective search space used: 42576939184
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
