Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC004174A_C01 KMC004174A_c01
(510 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|ZP_00117748.1| hypothetical protein [Cytophaga hutchinsonii] 32 3.3
>ref|ZP_00117748.1| hypothetical protein [Cytophaga hutchinsonii]
Length = 550
Score = 32.3 bits (72), Expect = 3.3
Identities = 15/44 (34%), Positives = 25/44 (56%)
Frame = +1
Query: 298 FPINSYNSIHYPLMCTNLFR*TKFNYEIPGVKHLRYHVSIPIPF 429
+P+NS N++ Y + F+ TK N + V YHV++ +PF
Sbjct: 154 YPVNSKNNMLYEYLAQE-FKFTKLNRTVTYVTKTEYHVAVILPF 196
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 407,243,330
Number of Sequences: 1393205
Number of extensions: 7809714
Number of successful extensions: 11240
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 11041
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11240
length of database: 448,689,247
effective HSP length: 114
effective length of database: 289,863,877
effective search space used: 15942513235
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
