Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC003477A_C01 KMC003477A_c01
(378 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|AAH26355.1| similar to putative [Homo sapiens] 30 9.8
>gb|AAH26355.1| similar to putative [Homo sapiens]
Length = 657
Score = 29.6 bits (65), Expect = 9.8
Identities = 18/51 (35%), Positives = 28/51 (54%)
Frame = +2
Query: 161 GMSPLYMTTSMRPLPYPCPVFISFDSILRYHQLHYAYIYHR*HYAYISMTL 313
G S Y+++SM P PV +FD +L Y+ L+YA H+ +SM +
Sbjct: 518 GTSQSYLSSSM-PAGCVLPVGGNFDILLHYYLLNYAKKCHQSEETMVSMII 567
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 303,838,592
Number of Sequences: 1393205
Number of extensions: 5706087
Number of successful extensions: 11797
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 11541
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11796
length of database: 448,689,247
effective HSP length: 101
effective length of database: 307,975,542
effective search space used: 7391413008
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
