Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC002372A_C01 KMC002372A_c01
(503 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_653661.1| PTS_EIIC, Phosphotransferase system, EIIC [Baci... 31 9.1
>ref|NP_653661.1| PTS_EIIC, Phosphotransferase system, EIIC [Bacillus anthracis
A2012]
Length = 433
Score = 30.8 bits (68), Expect = 9.1
Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 4/52 (7%)
Frame = +2
Query: 341 LLHPCMXLKLIL-IVSY---SWSSSLASSAALVSWSSSLAFSKSLGSDSKLS 484
LL P + + ++L IVSY W S A V W++ + FS LGS K+S
Sbjct: 348 LLIPFILVPVVLTIVSYFAMEWGLVARPSGAAVPWTTPILFSGYLGSGGKIS 399
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 366,793,265
Number of Sequences: 1393205
Number of extensions: 6469691
Number of successful extensions: 16706
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 14176
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16055
length of database: 448,689,247
effective HSP length: 114
effective length of database: 289,863,877
effective search space used: 15362785481
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
