Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC002088A_C01 KMC002088A_c01
(245 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_701170.1| hypothetical protein [Plasmodium falciparum 3D7... 30 9.0
>ref|NP_701170.1| hypothetical protein [Plasmodium falciparum 3D7]
gi|23496235|gb|AAN35894.1|AE014840_42 hypothetical
protein [Plasmodium falciparum 3D7]
Length = 609
Score = 30.0 bits (66), Expect = 9.0
Identities = 12/30 (40%), Positives = 19/30 (63%)
Frame = +3
Query: 75 NIEFATHSLSYMC*NINSFXVIEMFXXPKN 164
N+ F T L YMC +++ F ++ +F PKN
Sbjct: 262 NLPFKTFMLWYMCISVSFFFLLTIFLFPKN 291
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 150,772,804
Number of Sequences: 1393205
Number of extensions: 2223212
Number of successful extensions: 4172
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4129
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4172
length of database: 448,689,247
effective HSP length: 57
effective length of database: 369,276,562
effective search space used: 8862637488
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
