Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC001422A_C01 KMC001422A_c01
(514 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_245645.1| unknown [Pasteurella multocida] gi|12720996|gb|... 31 7.4
>ref|NP_245645.1| unknown [Pasteurella multocida] gi|12720996|gb|AAK02792.1| unknown
[Pasteurella multocida]
Length = 179
Score = 31.2 bits (69), Expect = 7.4
Identities = 17/61 (27%), Positives = 30/61 (48%)
Frame = -1
Query: 493 KEVDTWLKVIFLRMV*REPQSGRRFGYSVMSFNTTFLRTWQCECAKAWLSSKIVKITRGQ 314
+++ L +FL P+ R G S++S + + + C+C +A L KI+ T Q
Sbjct: 2 RKLTALLITLFLTGCITAPKGLEREGVSLLSLDKLVVEDYACQCKQARLGGKILSATALQ 61
Query: 313 G 311
G
Sbjct: 62 G 62
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 416,667,337
Number of Sequences: 1393205
Number of extensions: 8387181
Number of successful extensions: 16944
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 16701
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16944
length of database: 448,689,247
effective HSP length: 114
effective length of database: 289,863,877
effective search space used: 16232377112
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
