Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000989A_C01 KMC000989A_c01
(591 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_440506.1| cytochrome oxidase d subunit II [Synechocystis ... 33 2.7
>ref|NP_440506.1| cytochrome oxidase d subunit II [Synechocystis sp. PCC 6803]
gi|7427820|pir||S75272 cytochrome d ubiquinol oxidase
(EC 1.10.3.-) chain II - Synechocystis sp. (strain PCC
6803) gi|1652263|dbj|BAA17186.1| cytochrome oxidase d
subunit II [Synechocystis sp. PCC 6803]
Length = 336
Score = 33.1 bits (74), Expect = 2.7
Identities = 21/69 (30%), Positives = 32/69 (45%)
Frame = -1
Query: 291 LLVCVTINIFS*LPALALLFFCFEVLELYFRVLLSDEKCPFFLFSLGFIGFGRFRLVGKA 112
L + IF+ +P + LLF + LY R + F +FSL FIG G
Sbjct: 229 LFTAPLVYIFAAIPLVGLLFIGLLLRSLYLREENTPIIWTFLVFSLSFIGLG-------- 280
Query: 111 FLLLPLVLP 85
F++ P ++P
Sbjct: 281 FIIFPNIIP 289
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 522,825,310
Number of Sequences: 1393205
Number of extensions: 11232558
Number of successful extensions: 32281
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 31262
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32249
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 22569056698
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)