Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000958A_C01 KMC000958A_c01
(532 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_703666.1| erythrocyte membrane protein 1 (PfEMP1) [Plasmo... 31 8.0
>ref|NP_703666.1| erythrocyte membrane protein 1 (PfEMP1) [Plasmodium falciparum 3D7]
gi|23498327|emb|CAD50275.1| erythrocyte membrane protein
1 (PfEMP1) [Plasmodium falciparum 3D7]
Length = 3954
Score = 31.2 bits (69), Expect = 8.0
Identities = 18/48 (37%), Positives = 24/48 (49%)
Frame = -2
Query: 369 QLTVIIGFVDGRSF*NVRNLNEFFLDT*RWKQPSEGLGLQQL*MKACD 226
Q ++ D F NV L+E+F D RWK P E + + L K CD
Sbjct: 3355 QFKKVLNNKDAEEFLNVHCLSEYFKDETRWKNPYESIADKALKGK-CD 3401
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 410,993,640
Number of Sequences: 1393205
Number of extensions: 8050980
Number of successful extensions: 13926
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 13656
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13921
length of database: 448,689,247
effective HSP length: 115
effective length of database: 288,470,672
effective search space used: 17596710992
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
