Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000926A_C01 KMC000926A_c01
(486 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_239907.1| flagellar M-ring protein [Buchnera sp. APS] gi|... 32 2.9
>ref|NP_239907.1| flagellar M-ring protein [Buchnera sp. APS]
gi|11386782|sp|P57175|FLIF_BUCAI Flagellar M-ring
protein gi|25304707|pir||A84938 flagellar M-ring protein
[imported] - Buchnera sp. (strain APS)
gi|10038758|dbj|BAB12793.1| flagellar M-ring protein
[Buchnera aphidicola str. APS (Acyrthosiphon pisum)]
Length = 545
Score = 32.3 bits (72), Expect = 2.9
Identities = 12/31 (38%), Positives = 19/31 (60%)
Frame = -3
Query: 370 FSTNTFLYNYLP*MCVYKLVIVLFEKFALPF 278
F + FLYN+ P C + L+ +L +K+ PF
Sbjct: 446 FRKSNFLYNFAPWFCSFALLFLLLKKYICPF 476
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 370,897,937
Number of Sequences: 1393205
Number of extensions: 7302866
Number of successful extensions: 11348
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 11164
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11346
length of database: 448,689,247
effective HSP length: 113
effective length of database: 291,257,082
effective search space used: 13980339936
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)