Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000848A_C01 KMC000848A_c01
(976 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_066348.1| SecY-independent transporter protein [Malawimon... 33 5.1
>ref|NP_066348.1| SecY-independent transporter protein [Malawimonas jakobiformis]
gi|10178703|gb|AAG13715.1|AF295546_41 SecY-independent
transporter protein [Malawimonas jakobiformis]
Length = 251
Score = 33.5 bits (75), Expect = 5.1
Identities = 11/30 (36%), Positives = 22/30 (72%)
Frame = -3
Query: 209 LCSLITYPEFLTFPLLFFYFVLFLSKFVLY 120
+ S +T P+F++F +LFF+F++F F+ +
Sbjct: 205 IISFVTPPDFMSFLILFFFFIVFYEFFIYF 234
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 806,768,696
Number of Sequences: 1393205
Number of extensions: 16951632
Number of successful extensions: 33342
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 32206
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33325
length of database: 448,689,247
effective HSP length: 123
effective length of database: 277,325,032
effective search space used: 55742331432
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
