Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000715A_C01 KMC000715A_c01
(1042 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_389758.1| similar to hypothetical proteins [Bacillus subt... 33 9.6
>ref|NP_389758.1| similar to hypothetical proteins [Bacillus subtilis]
gi|6137261|sp|O34416|YOAV_BACSU Hypothetical transport
protein yoaV gi|7474661|pir||G69897 conserved
hypothetical protein yoaV - Bacillus subtilis
gi|2619001|gb|AAB84425.1| YoaV [Bacillus subtilis]
gi|2634270|emb|CAB13769.1| yoaV [Bacillus subtilis
subsp. subtilis str. 168]
Length = 292
Score = 32.7 bits (73), Expect = 9.6
Identities = 14/35 (40%), Positives = 22/35 (62%)
Frame = -2
Query: 504 IVFPFGLPFLCFFQAALIWRLCAIVFFISWGLSNL 400
++F FG L Q+AL LC +V +SWG++N+
Sbjct: 132 LLFIFGKEMLNIDQSALFGELCVLVAALSWGIANV 166
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 878,412,359
Number of Sequences: 1393205
Number of extensions: 19268952
Number of successful extensions: 37690
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 36188
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37679
length of database: 448,689,247
effective HSP length: 124
effective length of database: 275,931,827
effective search space used: 61256865594
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)