Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000504A_C02 KMC000504A_c02
(734 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_224315.1| CT058 hypothetical protein [Chlamydophila pneum... 34 1.9
>ref|NP_224315.1| CT058 hypothetical protein [Chlamydophila pneumoniae CWL029]
gi|15835643|ref|NP_300167.1| CT058 hypothetical protein
[Chlamydophila pneumoniae J138]
gi|16752938|ref|NP_445209.1| hypothetical protein
[Chlamydophila pneumoniae AR39] gi|7468038|pir||C72118
hypothetical protein CP0667 [imported] - Chlamydophila
pneumoniae (strains CWL029 and AR39)
gi|25403741|pir||D86504 CT058 hypothetical protein
[imported] - Chlamydophila pneumoniae (strain J138)
gi|4376369|gb|AAD18260.1| CT058 hypothetical protein
[Chlamydophila pneumoniae CWL029]
gi|7189581|gb|AAF38479.1| hypothetical protein
[Chlamydophila pneumoniae AR39]
gi|8978481|dbj|BAA98318.1| CT058 hypothetical protein
[Chlamydophila pneumoniae J138]
Length = 257
Score = 34.3 bits (77), Expect = 1.9
Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 4/55 (7%)
Frame = +1
Query: 385 RDELAKSNCKNTHLNCPVFRKTLDAITLLQI----QGLRSAPDRFKIPNSSVQKL 537
+ + A CKN +LNC +TL +T LQI G+ + P+ K PNS K+
Sbjct: 153 KSQAAFDRCKNAYLNCFSLAQTL-GVTFLQIPLISSGIYAPPENRKKPNSEENKV 206
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 562,165,623
Number of Sequences: 1393205
Number of extensions: 11098149
Number of successful extensions: 24489
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 23966
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24482
length of database: 448,689,247
effective HSP length: 120
effective length of database: 281,504,647
effective search space used: 34906576228
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
