Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000390A_C01 KMC000390A_c01
(632 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|EAA40610.1| GLP_23_17721_13564 [Giardia lamblia ATCC 50803] 32 9.1
>gb|EAA40610.1| GLP_23_17721_13564 [Giardia lamblia ATCC 50803]
Length = 1385
Score = 31.6 bits (70), Expect = 9.1
Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 10/63 (15%)
Frame = +2
Query: 86 IGIITQPCITPTKKQGEKGY---EGRMSNDKLKTL---FLPNPTISIHLNHN----TQLP 235
I + +P + P QG++ + + S + L+T FLP P++S+H + + TQLP
Sbjct: 1035 ISSVQEPILAPDAHQGKQAHSHSQPEFSRNYLETTTSTFLPQPSVSLHASTSQPLGTQLP 1094
Query: 236 SNT 244
S++
Sbjct: 1095 SHS 1097
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 549,440,420
Number of Sequences: 1393205
Number of extensions: 11692315
Number of successful extensions: 27256
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 26486
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27250
length of database: 448,689,247
effective HSP length: 118
effective length of database: 284,291,057
effective search space used: 26154777244
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
