Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000340A_C04 KMC000340A_c04
(566 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_507743.1| F-box domain containing protein family member [... 32 5.5
>ref|NP_507743.1| F-box domain containing protein family member [Caenorhabditis
elegans] gi|7499573|pir||T21203 hypothetical protein
F21D9.6 - Caenorhabditis elegans
gi|3876161|emb|CAB04159.1| Hypothetical protein F21D9.6
[Caenorhabditis elegans]
Length = 298
Score = 32.0 bits (71), Expect = 5.5
Identities = 21/62 (33%), Positives = 32/62 (50%), Gaps = 3/62 (4%)
Frame = -2
Query: 262 YGLCRPSLSGNIIY*DIIMIVLIF*KIIKLRTTFI---QVLFGIGDLNCNSVMILTWSLG 92
Y C LSGN+ DI + ++++L + FI Q +FG G+LN + + W LG
Sbjct: 153 YHYCHMMLSGNVFQHDIECPMFRINELLQLNSEFIELNQTIFGSGNLN---LFLKHWLLG 209
Query: 91 HT 86
T
Sbjct: 210 LT 211
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 461,894,362
Number of Sequences: 1393205
Number of extensions: 9355784
Number of successful extensions: 22024
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 21505
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22021
length of database: 448,689,247
effective HSP length: 116
effective length of database: 287,077,467
effective search space used: 20669577624
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)