Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000243A_C02 KMC000243A_c02
(600 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_071552.1| G protein-coupled receptor 5-1 [Rattus norvegic... 33 3.7
>ref|NP_071552.1| G protein-coupled receptor 5-1 [Rattus norvegicus]
gi|2370437|emb|CAA75008.1| putative G-protein coupled
receptor [Rattus norvegicus]
Length = 353
Score = 32.7 bits (73), Expect = 3.7
Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 7/48 (14%)
Frame = +1
Query: 199 CLH--YPNIMGV-----CSLQVL*CVSLGRHLIVKQQKISYLTKRPAC 321
CLH +P+++G CS+ L C+ + R+L + Q + S+ ++PAC
Sbjct: 119 CLHCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVQPEGSHRWRQPAC 166
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 477,821,940
Number of Sequences: 1393205
Number of extensions: 9434262
Number of successful extensions: 18789
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 18256
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18788
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 23426109484
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
