Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000209A_C01 KMC000209A_c01
(735 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_578577.1| hypothetical protein [Pyrococcus furiosus DSM 3... 32 9.3
>ref|NP_578577.1| hypothetical protein [Pyrococcus furiosus DSM 3638]
gi|18892879|gb|AAL80972.1| hypothetical protein
[Pyrococcus furiosus DSM 3638]
Length = 256
Score = 32.0 bits (71), Expect = 9.3
Identities = 14/42 (33%), Positives = 21/42 (49%)
Frame = -2
Query: 410 VSHLLNTTSITNSQHCICDPGYFVILKYLVTKKFKFGTLTFD 285
V ++ T + HC+ D Y +I + TKK GT+ FD
Sbjct: 97 VFDIIVTLRLKEPGHCVMDKAYVIIWRNNATKKAPLGTIEFD 138
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 564,753,792
Number of Sequences: 1393205
Number of extensions: 11152037
Number of successful extensions: 21962
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 21120
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21959
length of database: 448,689,247
effective HSP length: 120
effective length of database: 281,504,647
effective search space used: 34906576228
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
