Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000201A_C01 KMC000201A_c01
(535 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
dbj|BAC04540.1| unnamed protein product [Homo sapiens] 31 8.1
>dbj|BAC04540.1| unnamed protein product [Homo sapiens]
Length = 456
Score = 31.2 bits (69), Expect = 8.1
Identities = 19/57 (33%), Positives = 30/57 (52%)
Frame = +2
Query: 122 HSRQNKLTYIYCSNVIPDVNIICSLSLWQMNLLQSSSMWFGGIIT*PSMQDELSLLK 292
+S N + + NVIPD I+ +L W++N+L+ + F G + P LS LK
Sbjct: 119 NSLWNAIDFSSVKNVIPDKYIVSTLQRWRLNVLRLN---FRGCLLRPKTFRSLSPLK 172
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 435,481,126
Number of Sequences: 1393205
Number of extensions: 8918572
Number of successful extensions: 17720
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 17301
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17718
length of database: 448,689,247
effective HSP length: 115
effective length of database: 288,470,672
effective search space used: 17885181664
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
