Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000154A_C01 KMC000154A_c01
(770 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|ZP_00054199.1| hypothetical protein [Magnetospirillum magneto... 33 4.5
>gb|ZP_00054199.1| hypothetical protein [Magnetospirillum magnetotacticum]
Length = 184
Score = 33.1 bits (74), Expect = 4.5
Identities = 24/62 (38%), Positives = 32/62 (50%), Gaps = 5/62 (8%)
Frame = -1
Query: 431 GRPNAVDFGHGWYEFGRQKRVCARDQYGVYETPE-TDTYR---LEVRRH*IIKGLC-TFK 267
GR V FG GW E QK V +R + V + +D YR E+RR + G+C F+
Sbjct: 28 GRDRIVAFGQGWPEKTYQKSVLSRSLWDVVDDANISDIYRALVTEIRRTGL--GVCFAFR 85
Query: 266 CD 261
CD
Sbjct: 86 CD 87
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 621,204,521
Number of Sequences: 1393205
Number of extensions: 13240940
Number of successful extensions: 39335
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 35182
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37721
length of database: 448,689,247
effective HSP length: 121
effective length of database: 280,111,442
effective search space used: 37815044670
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
